PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v0841080.1
Common NameCBF-A01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YA
Protein Properties Length: 332aa    MW: 36369.9 Da    PI: 9.2716
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v0841080.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA98.76.2e-31159215158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      d p+YVNaKQy++I++RRq+Rak+ +e+kl +k  kpy+heSRh hA+rRpRg+gGrF
  Lj5g3v0841080.1 159 DGPIYVNAKQYHGIIRRRQSRAKAVQENKL-IKRSKPYMHESRHLHAMRRPRGCGGRF 215
                      57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-35157218IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.76158218IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.4E-26161215IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.6E-22161183IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.6E-22192215IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MAMQTVYLKE HERMGHSSVG QLSSVTSAPW WGSQSVYGDS CGQIKPFSLE FSNYVDHFAA  60
NKNSVRGAEQ LFDKGLTTQF TIFSDDCKMS GEAQNLEATL SLQPSVTVAE PRNRFELGFN  120
QPMICAKYPY MDQFYGLFSA YGPQIPGRMM LPLNLSTDDG PIYVNAKQYH GIIRRRQSRA  180
KAVQENKLIK RSKPYMHESR HLHAMRRPRG CGGRFLNTRN SSDGNGKSGS ELHKKTGGLG  240
RHMQSSASQS SEVLQSEVGT LNSSKETNGS SPNISGSEVT SMYSLGGLDS FAVNHLGSAI  300
HHSLADMIDG GHGIIMPTKW VGAAGSCFNL KV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-16159222265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.169880.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3786330.0AB378633.1 Lotus japonicus CBF-A01 mRNA for transcription factor CCAAT, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014623885.11e-178PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
RefseqXP_014623884.11e-178PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
TrEMBLB3IX330.0B3IX33_LOTJA; Transcription factor CCAAT
STRINGGLYMA02G35190.21e-176(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37943464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.21e-51nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Asamizu E,Shimoda Y,Kouchi H,Tabata S,Sato S
    A positive regulatory role for LjERF1 in the nodulation process is revealed by systematic analysis of nodule-associated transcription factors of Lotus japonicus.
    Plant Physiol., 2008. 147(4): p. 2030-40
    [PMID:18567832]